PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.S7JJM
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TALE
Protein Properties Length: 431aa    MW: 48290.8 Da    PI: 6.4565
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.S7JJMgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-093573931955
                  HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                   +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Aradu.S7JJM 357 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 393
                  45679*****************************885 PP

2ELK40.84.5e-14313334122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlrKYsgyLgsLkqEF+
  Aradu.S7JJM 313 ELKGQLLRKYSGYLGSLKQEFM 334
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.4E-19173217IPR005540KNOX1
PfamPF037905.4E-22174213IPR005540KNOX1
SMARTSM012562.6E-24224275IPR005541KNOX2
PfamPF037917.0E-21228274IPR005541KNOX2
PROSITE profilePS5121311.174313333IPR005539ELK domain
PfamPF037897.4E-11313334IPR005539ELK domain
SMARTSM011882.8E-8313334IPR005539ELK domain
PROSITE profilePS5007113.086333396IPR001356Homeobox domain
SuperFamilySSF466893.34E-19335410IPR009057Homeodomain-like
SMARTSM003891.2E-12335400IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.1E-28338398IPR009057Homeodomain-like
CDDcd000861.05E-11345397No hitNo description
PfamPF059208.2E-17353392IPR008422Homeobox KN domain
PROSITE patternPS000270371394IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MAETAVYQWQ YREEKRGEEF SLGRIVSVEK ADSFFYHKTR ETPSQHHIHP AMEAEGGSSN  60
GGPSSNCFMA FGENNNNSSS NNNNNSVSGS GLSPMMMMPL LTTNSHHPTN NLIPHQNHTS  120
TSNNIANIFL PNTNTSFMLE NNTTTTTTTT TTGLGYYFMD NNNGSSSSSS PSSAVKAKIM  180
AHPHYHRLLA AYVNCQKVGA PPEVVARLEA ACASAMSMAA AGDTSACLGE DPSLDQFMEA  240
YCEMLTKYEQ ELSKPLKEAM IFLQRMESQF KNLTISSSSR DLGSNEGNDG NNGSSEEDAD  300
LQSLIDPQAE DRELKGQLLR KYSGYLGSLK QEFMKKRKKG KLPKEARQQL LEWWSRHYKW  360
PYPSESQKLA LAESTGLDQK QINNWFINQR KRHWKPSEDM QFVVVDPTHP HYYMDNVLAN  420
PFSMDLPNTM L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1328337LKQEFMKKRK
2334338KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015958931.10.0PREDICTED: homeobox protein SBH1-like
SwissprotP466081e-166HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLO828051e-170O82805_PEA; Knotted1-like class I homeodomain protein
STRINGGLYMA09G01000.21e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-124KNOX/ELK homeobox transcription factor